DPCstruct | MC5304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016EQ47 | 1-88 | MFNCSQVSISDVLNCEIIVEDFIPDVKTSHGEGRYLVKFKHSNGADGKFFTNAASLKKTLDQIPKDAFPFSTTIKGMKCGNGKIYQFT |
| A0A7C6HXN7 | 7-109 | SLSFLNIEPDKSNRQFNCPEITQQKLINLQFFVVDYLDEIKTKYGNNRFLVKIKFNLEDSESEARKFFTNSKEIKYVLSKVKELNAF… |
| A0A662N2D9 | 2-95 | None |
| A0A564Q423 | 25-123 | None |
| A0A7J0B9V5 | 6-106 | None |
| A0A7J0AE39 | 58-176 | None |
| A0A5J4SZT1 | 467-588 | None |
| A0A5Q5FTW8 | 3-126 | None |
| A0A5J4QU98 | 106-221 | None |
| A0A4Q5H7S0 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.