DPCstruct | MC53039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 174 ± 36 aa |
| Standard deviation of domain lengths | 36.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | PF13850- PF07970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3ER86 | 25-193 | AGHIDVNKVAGAFHIAPGKSYGQGHIHVHDLMAFSGEQFPLSHEIRHLSFGDTYPGQVNPLDNTNMTVDAASPMISYFIKLVPTIYS… |
| A0A453LZP0 | 8-149 | VAGNFHISVHGLNIFVANQIFDGSSHVNVSHVIHRLSFGPEYPGIHNPLDDTSRILHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQF… |
| A0A1Q9CFW1 | 315-482 | None |
| S9VYR4 | 7-151 | None |
| A0A0G2GNX8 | 388-579 | None |
| A0A7S1NY09 | 2-165 | None |
| A0A397IQP6 | 25-234 | None |
| W7XED5 | 81-298 | None |
| A0A6A2Y909 | 191-336 | None |
| A0A287HWG6 | 171-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.