DPCstruct | MC53032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 150 ± 28 aa |
| Standard deviation of domain lengths | 28.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9VYS6 | 176-303 | LDESILHCSLSRARAEWQHKHQEDMAKKQVEALKNQKKNDALHAREEARRLGINSKKFDLPLRHYTRKEDLKDIAACMGLETTGKDV… |
| A0A0C9VKV0 | 2-114 | TSADMEVNVCSQIAAEQTRELEEAAAKQAKAAAALRVQEERILNKATRVFMGPIKVMKKSDLQGLAYALDLVFEGTKEELASRILQQ… |
| A0A0C9UEB3 | 67-202 | None |
| F8P032 | 289-454 | None |
| A0A0C9URE9 | 126-269 | None |
| A0A0C9VKF6 | 133-288 | None |
| A0A409XT59 | 191-349 | None |
| A0A0D0ADS1 | 2-176 | None |
| A0A067PFS8 | 35-192 | None |
| A0A0C9U6Z4 | 5-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.