DPCstruct | MC53030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 257 ± 48 aa |
| Standard deviation of domain lengths | 48.39 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.98 |
| Pfam Score | 92.56 |
| Assigned Pfam label(s) | CL0029- CL0123- PF02946- CL0219- CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8M8M5 | 1-207 | MFCASCIVESHSRLPLHWIERWNGQFFEASSLRSLGLRVQLGHGPHSRCINPKQAHSDDFAVIHVNGIHSVAVNFCGCPGAEEHYMQ… |
| A0A0C9VDQ4 | 172-473 | TGPPSFGLYSPGHEFTPHQLNGYMGYDDGDDGVDVVEETDWLGLDGFGTGNDDEDVDLDPRSQTRRKRYQASDAPLHDWLQVRQIFL… |
| A0A6A4GLA6 | 160-392 | None |
| A0A7J5YDP7 | 2-200 | None |
| A0A6A4GNB8 | 53-310 | None |
| A0A6A4GQX8 | 1-196 | None |
| A0A6A4GYZ1 | 16-279 | None |
| A0A6A4H118 | 14-221 | None |
| E3KK71 | 37-290 | None |
| E3KPG4 | 196-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.