DPCstruct | MC53025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9V0Z6 | 1-87 | MQFYTSNSLLLHPLVSPALGYLGGLPPLFVIASDKEVLRDEIIYLAHKAAYPDRFPIHEDAKILYPHINDIKEPRPTFVHLQVYDGM |
| R7SIC5 | 41-136 | GQVHMYTPNYLLTHPLVSPVVSYLGGLPPLLVSAGDKEVLRDEIIYFAHKAAHPEKYPVKPESKLLYPALEGIEQRCGPTKVHLQVY… |
| A0A180H191 | 468-563 | None |
| A0A5B0Q9H4 | 87-181 | None |
| A0A2N0P1D7 | 1-91 | None |
| A0A1W5D0U5 | 86-181 | None |
| E9E0X3 | 1-91 | None |
| A0A372RHJ4 | 132-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.