DPCstruct | MC53023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 149 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HQD9 | 378-512 | GSRVISAFREGPHDRIYDPELRAIWKEMGWKLSVPVEEFVHTVHDYYVAQYSDSSIVSDHFRSPPLPDSTLEDQIVALREAFSAAKQ… |
| A0A0C9USC7 | 4-167 | FIAKLEIQEQELKASIERQGDRIIAYFSGRHEKIIDPQLREVWKEMGWKGAVKASTFVFALRDYFSSNFKRDPAKEDSHTSTQSLGN… |
| A0A4V4HHG5 | 1-133 | None |
| A0A0C9UH67 | 2-133 | None |
| A0A0C9UDA6 | 168-357 | None |
| A0A4Y7QDV0 | 321-458 | None |
| A0A165T0I8 | 454-594 | None |
| A0A4Q2DKH2 | 213-371 | None |
| A0A2R6QBH8 | 81-230 | None |
| A0A0W0FDP9 | 552-684 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.