DPCstruct | MC53014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 139 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02570 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847KAS6 | 1-135 | MYEQIAPQAIMSKSLAIIDAGVDLSGFGDGEKEIVCRCVHASGDFGIAGSIRFSPGAVETGVRLIKERVPIFADVSMVAAGISPSLQ… |
| A0A6N7YL10 | 2-139 | IDYLKDGPEIYRRSFATIRDEADVAILPEDLEPVAVRMIHSCGMVDLVDDLAYSLEVVESARDALRAGAPVLCDAHMIASGITRRRL… |
| A0A2S4MEN0 | 436-572 | None |
| A0A1I3L534 | 330-467 | None |
| A0A1I3RFH1 | 304-441 | None |
| A0A1V5HVK1 | 22-177 | None |
| A0A521KGZ9 | 5-152 | None |
| A0A7J5GUX6 | 120-272 | None |
| A0A6P4KFP5 | 3-139 | None |
| Q6L326 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.