DPCstruct | MC53013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 139 ± 19 aa |
| Standard deviation of domain lengths | 19.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847K6G0 | 3-135 | KQNLKEDWIAALLELMKQLKQWTVEQIKIWEADPLQSIVPVVIESPVRRDEELLGRYFAPSLIITEENFHVEICPVKRFAIGPIGLV… |
| A0A7W0RQ28 | 89-205 | DALGAVTIWQSEVHTLCVRIREWIRELGEDVYIEAETVALHEPQAGHYRADGLRIRFGVGEMVVRPVARWVVGANGRVDFLGSEERF… |
| A0A2U8WLY8 | 83-226 | None |
| A0A847KBW8 | 8-133 | None |
| A0A7W1LAE5 | 2-126 | None |
| A0A4Y5Z408 | 47-201 | None |
| A0A7X9GDT4 | 2-109 | None |
| A0A432S0I5 | 10-174 | None |
| A7C125 | 1-129 | None |
| A0A6B1HD51 | 61-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.