DPCstruct | MC53004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11753 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1R5T8 | 111-182 | VPECFYRGADSINHPPHYTQGKIEVIDFIADQQMGYMDGNIIKYIARYRHKGSAVEDLKKAKWYLERLLAEV |
| E5YB79 | 9-74 | DQIRPPYYTRFRIEPLAFITMNHLDFLQGNIIKYVCRYDGKNGAEDLMKARRYLDELITRTQTEEG |
| A0A1R3L3S5 | 228-298 | None |
| A0A359YI33 | 1-76 | None |
| A0A7I8C6V1 | 32-106 | None |
| A0A3D6BU30 | 1-65 | None |
| D6DZ92 | 1-71 | None |
| C5R845 | 5-71 | None |
| A0A6S6Z150 | 70-134 | None |
| A0A3N5C5Q6 | 148-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.