DPCstruct | MC5300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7UP09 | 1-179 | MLDPSMILENNNLSFFGKFISELDFYNYKVISSQNTYIYKVIIPGAHFYISTNKTSYIWGERNCHYYINGDKQPPHFIYLNNDNKNP… |
| A0A377YXV6 | 48-213 | SLCDVQRWKGCHPERDSTPEGILAVLHDWEWGLDQEVVFHSGNMSARYIPAARNLCWQVSVDSSEVTFTGHSSCKTTIYGSSGTRYN… |
| A0A376U7M9 | 1-143 | None |
| A0A2X1Q5F1 | 29-182 | None |
| A0A655MVY5 | 2-181 | None |
| A0A376ZWW3 | 1-208 | None |
| S7IM89 | 130-340 | None |
| A0A381KSF2 | 384-566 | None |
| A0A377VS22 | 583-786 | None |
| G4NNB0 | 264-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.