DPCstruct | MC530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 202 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2UUK9 | 2-176 | ISFGKSTSKSYNKAVYLAKNSPKYDEVVDEDGNITHTATYTSSKRDFLDFIVLYDLVSNWKSTFFIINGDLVDKKTVGKIKYCYGDK… |
| A0A1H6FB93 | 152-391 | ALLESQKKQSPCFDPKKNKGLCLAFDQDIHSDVLLHLARSAPKYQEIAKSEQAGEHLWSFATWPQQKILDALPLATQLSKQSETQRG… |
| A0A0S6W3I7 | 139-358 | None |
| A0A7X8KM39 | 186-381 | None |
| A0A1Y4GVB9 | 50-250 | None |
| G2ZT69 | 2-172 | None |
| A0A1H2YKW1 | 192-411 | None |
| A0A4R7DUZ6 | 151-384 | None |
| A0A073IQ68 | 80-293 | None |
| A0A8A7KJ64 | 41-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.