DPCstruct | MC53
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5DZ94 | 17-110 | NLKSVIMAALLVALHTVFAMFLSIQVTDSLRISVSFIANVAAGCLFGPVMGFVCGGIGDIIQFVLKPTGPYFPGWTLSAALAGFIYG… |
| T0UA49 | 1-98 | MKRKVDAHMIAVMGLLIALMVVLSQILGFETAYLKLTFTFVPELIMGMLFGPFWTAVGASVADIAGMILFPKSAYFFGFTINAFVGG… |
| A0A8A5CVC2 | 26-115 | None |
| A0A7X7Y356 | 1-98 | None |
| A0A397RYM9 | 252-342 | None |
| A0A1I6KDB1 | 46-146 | None |
| R6RCK3 | 194-286 | None |
| A0A1J6YK85 | 2-99 | None |
| A0A354MSB5 | 35-124 | None |
| A0A511AXT8 | 143-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.