DPCstruct | MC52999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2UWI5 | 46-160 | TGIMEAVLAEGKTPEDILEIAKAQIKATGRVLITRLNEDQTSCMNNEFGSERIDWGIHHRTAAVHDGTPIIKTGGVVAIISAGTADI… |
| A0A7G7MSK6 | 336-477 | DLDREQRSGLPEVVYGPGKTPEAISGVVRELLAANTGPVLVTRIEAGAAAEVAVPGGTYDAAARLLVWRPAPSRGFRVVVASAGTSD… |
| A0A1N7INC9 | 34-171 | None |
| A0A2V7JDW0 | 11-122 | None |
| A0A1G3AQW0 | 1-156 | None |
| A0A5C6AMN6 | 98-235 | None |
| K0SER5 | 130-326 | None |
| A0A7Y5VB81 | 260-414 | None |
| A0A256ZX59 | 43-184 | None |
| A0A0E3HA92 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.