DPCstruct | MC52992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 124 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.12 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0123- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0A2P5 | 19-148 | RSNLETLLAKKISSVRYPMQELELNYPTTKGKVYSEEEDRYLLCRLNYYGMRADDVYERIKKDISEFPVFRFDWFFKSRSTQELQRR… |
| A0A3L6UUT8 | 127-242 | IQRLADQTALKIKRYANPYDDLVINYQGKGGKLFTEEEDRLLLCLVHTYGYGSWEKIKREIHAAPVCAFDYYLRSRSAAELGRRCDA… |
| A0A2J6KTL1 | 2-91 | None |
| A0A7S3ZYE5 | 358-486 | None |
| A0A0A9XCT6 | 394-506 | None |
| A0A7S2RM12 | 76-226 | None |
| A0A7J7LSD4 | 1-75 | None |
| A0A7C9EEA4 | 7-136 | None |
| A0A6A4JR15 | 78-218 | None |
| W7TLA4 | 293-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.