DPCstruct | MC52991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 191 ± 32 aa |
| Standard deviation of domain lengths | 32.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 86.32 |
| Assigned Pfam label(s) | PF18035- CL0036- PF05529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E2B9 | 1-193 | MEVQTTVIHVVLGINLLMNVILLFPWFDNVKRWFIQFYAYNMVFKTIRHIFNIFYVMIGVLLVDSAYKMNITESKLLEYQSQRNMYL… |
| A0A4Z0A1Y5 | 2-198 | TFMLLAGEMGTFCLLVAPLPFQVKRKLFHFLSESPVIAKIAYGLKISFIFVAILFVDALQRMFRVTAEVELAKTGQQIQDVRTETNF… |
| A0A1E4T9C2 | 327-495 | None |
| A0A654GK30 | 2-161 | None |
| A0A1W0XA20 | 74-292 | None |
| F4Q7U5 | 147-301 | None |
| A0A1B0BRT6 | 1-219 | None |
| A0A1S8VFS8 | 21-229 | None |
| A0A183SFM1 | 795-1055 | None |
| A0A7F8RX41 | 145-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.