DPCstruct | MC5299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 309 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096MBY8 | 1-292 | MAAGGSTSELDVSLNDDQENTLLLNGFKKLPVPLSTTQGGDSVFLWYKEDANPGITRIQFSYTSDMENNLQASGYQKVDKNLNTSGS… |
| A0A6P7P746 | 109-399 | MAEYITDLKVSVTEQEETELRGQGYTVLPENLNPDGRVKIYLWYKKGHGGAISRIQFSFLSSMTSGLHEAGYRKINKNLNEGTAGDT… |
| A0A0C9XWW3 | 573-880 | None |
| A0A6P8U5F6 | 12-330 | None |
| A0A498M175 | 119-430 | None |
| A0A1G6AH03 | 29-312 | None |
| A0A421F4Y8 | 56-419 | None |
| A0A0W8DPQ4 | 91-372 | None |
| A0A2R6RPM9 | 150-469 | None |
| K5WPE5 | 156-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.