DPCstruct | MC52987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1LX89 | 1-95 | MLKWYAGSQSRWSTNFTADVWHNVAFGIDFGANSVTFYHSAGADPLIQTAGPVATSTSSNGADWHLGVLRLPKAGVSDGGAEDWYYS… |
| A0A4Y9ZSN8 | 3-119 | LFSTPFAPQTWHNFAVIVDWTDRTLAVLYSQNGSHLTKVTGVVANTGAAEGAAGRGDFHFGVLKLPLVDLTDTPAEQADVVHFGIQE… |
| A0A0L6VNT6 | 136-247 | None |
| F4S4I1 | 15-136 | None |
| F4RXS0 | 12-117 | None |
| A0A061HES4 | 40-136 | None |
| K2RZ35 | 60-151 | None |
| B2VWV9 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.