DPCstruct | MC52986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 163 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369JES6 | 377-537 | EAIFALPATRVVAYLLPFKLRLIEELGGYSQWEKLNDDEKAALDVKIVREIGLEVFQCLSKTDQEKLTRFIRTGCCMHKDLNTFKWG… |
| A0A060STD5 | 690-847 | KAHAELPITELLLIVAEETTAAIEREGGATAWDQLTPEGLEARNVEIAHAVIVRIGEDAYAKLSESDRGLADLFIHAGCCMHKELNT… |
| A0A0C9UHR9 | 93-251 | None |
| J0WP63 | 127-289 | None |
| A0A284S544 | 418-586 | None |
| A0A284RVI9 | 16-177 | None |
| A0A0C9VYQ2 | 3-158 | None |
| B0DD03 | 3-170 | None |
| A0A4Z0A4M3 | 1-161 | None |
| A0A0C9ULU7 | 12-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.