DPCstruct | MC5298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 516 ± 36 aa |
| Standard deviation of domain lengths | 36.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 63.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5N5H5 | 78-528 | VDERLRLARERREEHLKQIASRERGWLAREERARRFYERHLEERRKKLEEQRQREERRRNAVEEKRRQRLKEERERYESVVQKTMER… |
| A0A096LYT9 | 2-557 | KTDDRMRLARFNLEHRETGATAREQLIREKERRARLQYERTVEERWRRLEEQRQKEELRRAAVEEKRRQQLEEERERLEALMKRSLE… |
| A0A6P7ZB39 | 27-588 | None |
| A0A803Y7B4 | 66-617 | None |
| A0A6J0UX56 | 176-671 | None |
| A0A3P8XQC3 | 25-572 | None |
| A0A3Q2XZC6 | 107-611 | None |
| A0A1L8F3B1 | 45-574 | None |
| G3UH80 | 1-523 | None |
| A0A5N5NUU9 | 58-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.