DPCstruct | MC5297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 59.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495XE77 | 94-155 | PPPPPPPAPRCDPNYDGCVPIASDVDCAGGSGNGPAYVRGPIHVIGDDIYDLDRDGDGIACE |
| D3D7D9 | 177-240 | AAPAPDPRAGCEPSYPGTCLRSGIGDYDCAGGKGDGPNYVRGPLRVTPPDPFDLDRDGDGYGCT |
| A0A359F250 | 451-516 | None |
| A0A660KVB2 | 203-265 | None |
| A0A444AWP2 | 299-357 | None |
| E3JB56 | 155-223 | None |
| A0A1V5J3V4 | 74-130 | None |
| A0A7U2PZN0 | 5-59 | None |
| A0A2M8PNB2 | 33-97 | None |
| A0A315TCR7 | 152-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.