DPCstruct | MC52963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 96 ± 3 aa |
| Standard deviation of domain lengths | 2.98 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 81.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I9KMB7 | 7-100 | WDDEGQVWYRDRGEWADAEEVERHLASACRVVLHGFRRPMQWLTSAEAAARWRQIRPHCAVPGQYGADGDAEGLTYAAVLWRRGDRQ… |
| A0A4U1J2G8 | 237-333 | WTDDGVLAATRLRTLDRVAIRDLLRRGPVRFVVADVGHDLRWIPPAERFDFWKRDGEIHFALTKEVHLDDLPDGMAYLASEWTVAGD… |
| A0A5C6J572 | 164-263 | None |
| A0A6G7P9R5 | 55-146 | None |
| A0A0A0J9R1 | 22-116 | None |
| A0A1V2P855 | 26-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.