DPCstruct | MC52956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 998 |
|---|---|
| Mean domain length (aa) | 119 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF20944- CL0737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P1B9P1 | 59-145 | PTKVIDSTATIPATLPNMTQPTLKVKLSTSNWQPTLQLPAKAQVGDKVVIVSNASADTYINAANGLTTAIKNGENRRFIYTAQGWTV |
| A0A3A6MP92 | 50-167 | TLSENLIVGGTSALGDDVTFTESIVLTPNTFSATTGAISLTADYTYYNITPTGTITLTLTTTGASIGQLLVITNKAAQNIVIADTIV… |
| A0A2N2WCE2 | 168-260 | None |
| A0A2N2WCC5 | 829-924 | None |
| A0A2S1LTV3 | 157-263 | None |
| A0A4Q1EX93 | 77-193 | None |
| A0A5C7YAI5 | 273-361 | None |
| A0A4Q8RTX9 | 236-335 | None |
| A0A7W1H8E0 | 92-202 | None |
| A0A519N1E5 | 202-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.