DPCstruct | MC52939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2BH11 | 4-95 | MGCAILGVMGIIIFLLTPFVPNILDILAPINVSRTRQLPIPGQYFVDQQKYFYAIVLHLDINVIIIVTTLLGTESLYIMHVQHACGL… |
| A0A158NKE9 | 30-113 | YVSTISFTTTSLAPRILDIVFPLNTSRPIMLAYPAYYFVDENQYFYYIFLHMLLTSSVCMTGLIAHDSMFFIYIEHICGLFAVV |
| A0A6P3XFT3 | 320-430 | None |
| E2BWZ5 | 2-97 | None |
| E9ITB4 | 14-105 | None |
| A0A6J1R9R7 | 3-104 | None |
| A0A6J1QW68 | 50-142 | None |
| A0A6J1R375 | 16-102 | None |
| A0A6J1R571 | 9-97 | None |
| A0A4S2K133 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.