DPCstruct | MC52937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 164 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SIY7 | 1-181 | MLSSSLQIVISSSLADLLLQSSCTLPYFMAIRCGYTVGRSTGESSLKDQLKTFQPRVLPVEDKKRYTQAQLSRPPNPAHEKLVSKCI… |
| A0A2I4BSW6 | 2-141 | RRIFAENPNWSLVLVPSLSNICLQSIVKNFEVNPVFRELTPSQRLWVQETLSPSLPLSVTASLIPDGVYWKRCCERRWDLCDVSRYG… |
| X6MEG0 | 16-181 | None |
| D8RGC0 | 11-149 | None |
| C1MWL1 | 14-173 | None |
| A0A5E4QBR0 | 12-162 | None |
| A0A0G4HZP1 | 59-247 | None |
| A0A0G4IED2 | 50-240 | None |
| A0A811UAL9 | 172-305 | None |
| D6WNC5 | 2-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.