DPCstruct | MC5293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 5.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377AND0 | 75-163 | LQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKTQFLEVYPQGFSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGY… |
| A0A377HPE6 | 1-86 | MQEQAGGPPFNPVEMGSESWEQIIDKLRQDPAVVAMFDKVYDGEINGNTITDAIAEFEKTLITPNSRFDQYLLGNADILSPEEKRG |
| A0A1F7RYB0 | 70-162 | None |
| A0A4Q7IPA3 | 92-179 | None |
| A5L5Q4 | 217-305 | None |
| G4CNA1 | 158-247 | None |
| A0A5M8FPC8 | 28-120 | None |
| A0A448SQW5 | 2-77 | None |
| A0A2N1XTI6 | 1-99 | None |
| A0A2X3K1A0 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.