DPCstruct | MC52925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5JUN2 | 8-129 | RTPPACCADLCGIRWRQLVYGERPNASSDPLDDPVLRSYSKCLAVDILCVWRRVAAPKPKPKLDPDPSSMFDMSIPGTGNSGSVLHP… |
| B3S593 | 1-99 | ADVKGLKWRRYQARTDTASLPLSDPILVSYANALAQDVLCVWQHLNGMKELWLFWFGDDPNLSNILSSELKDVEYGTFKDGFTYRCR… |
| A0A4Y2V915 | 12-133 | None |
| A0A482VLE3 | 1-113 | None |
| A0A0N5DBP5 | 94-186 | None |
| A0A6I9Z0I4 | 1-128 | None |
| A0A0P0WMZ2 | 2-135 | None |
| A0A5S6Q3U5 | 11-112 | None |
| A0A815V0H7 | 1-123 | None |
| A0A182ILY8 | 57-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.