DPCstruct | MC52921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804RRG4 | 22-138 | HSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFLLYTMFVWWRDVLRESTLEGHHTKAVQLGPRYGSILFIVSE… |
| A0A4Q3F5E6 | 11-120 | QFQYHPFHLVEASPWPILTANATLSMMIGAVLYFNGIAHGSTLVTLGFLSTLFAFILWFRDVTTEGTYLGDHTLIVQKGLTMGVSLF… |
| A0A5A7R0C5 | 7-123 | None |
| A0A0P0I8Y7 | 1-115 | None |
| A0A0D2NV83 | 14-115 | None |
| A0A1R0GL00 | 3-127 | None |
| A0A5N6P2K7 | 228-345 | None |
| A0A445HQS0 | 7-123 | None |
| A0A446M8D1 | 24-135 | None |
| A0A7E4S9N9 | 4-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.