DPCstruct | MC5292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 16.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1MCK9 | 1-75 | MFTEPWEATAFGVAIALSDQKSYEWEFFRQRLIHSIAEANGCEAYYESWTKALEASVVDSGLISEDEIRERMESM |
| A0A0M6ZW10 | 11-116 | PRLPLDQEGGPVFTAPWEARVFAMTLQAHEAGLFAWHEWAEHLGAELAKDGDGSGETIGYYDHWLTAFEKILCGKGIAATDTLGDLK… |
| A0A2H5YI88 | 1-109 | None |
| A0A381NNV7 | 2-78 | None |
| A0A7W2B5S6 | 18-117 | None |
| A0A2A5YZQ5 | 38-146 | None |
| A0A5Q4DYX9 | 2-83 | None |
| A0A2V6TTR4 | 7-105 | None |
| A0A3E0NMJ7 | 7-119 | None |
| A0A2A4ZLC2 | 4-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.