DPCstruct | MC52917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 422 ± 53 aa |
| Standard deviation of domain lengths | 52.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3EDB1 | 2-424 | GRKRKGVGATTGSRPKAAKVPKKTEDTDEQGILAIKLAAKTGIKHQYHDIMIPWLEKQSIESTKISELASLLFLNKVRLEYDRSIAS… |
| A0A662Y9K8 | 5-430 | SDEEGDAPVLPRRVRRADIVARKDLNKVTDFSVVKTTLNKFCKSKARALPWDEVLADMNKGVLEAYLLANVHVLRLCKAGLPIPPLT… |
| G4ZRB4 | 1-436 | None |
| A0A367JUE0 | 1-443 | None |
| A0A5D6YC04 | 62-524 | None |
| A0A1X2GR29 | 171-561 | None |
| A0A1X2GTV0 | 65-468 | None |
| A0A1X2GVJ8 | 153-499 | None |
| K3WN19 | 1-372 | None |
| A0A507D8Q9 | 268-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.