DPCstruct | MC5291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 63 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02965 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810ZSK8 | 4-56 | AAVSGWYFSHPESKYFAVAQLQRDQIEDYARRKGMSVTDVERWLAPNLGYDAD |
| M3HLV2 | 4-55 | ASSVSGLYFAHPKSKYFAVAKINRDQVEDYAKRKEMSVEVVERWLAPNLSYD |
| A0A556TWT1 | 1180-1233 | None |
| A0A7H4MB81 | 3-64 | None |
| A0A2K8U605 | 820-883 | None |
| A0A7W0NT92 | 9-63 | None |
| A0A7W1K6F0 | 95-149 | None |
| A0A2V6AXS4 | 231-292 | None |
| A0A7S0G2M4 | 116-190 | None |
| A0A7W1YXP2 | 1063-1128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.