DPCstruct | MC52905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9HTH8 | 1-75 | MDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVKSAYYDPKTRSMREDPLPDADPNEKFYEVRVIINIE |
| A0A1X6NNS2 | 2-75 | QTKDSGGTRATIRNLRIREDPAKYLRNLDVNSAYYDPKTRAMRADPTPHVSALDKDFAGDNFVRFSGDVQRLGT |
| A0A1A9X781 | 66-134 | None |
| A0A814EUW2 | 31-122 | None |
| A0A1B0C697 | 158-225 | None |
| A0A6G0RVC6 | 1-66 | None |
| A0A830CAB6 | 5-83 | None |
| A0A7S2WBJ8 | 199-275 | None |
| A0A058Z8W3 | 30-111 | None |
| A0A5K3FT34 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.