DPCstruct | MC52900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 22.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S9QNI2 | 66-216 | ADPPDVEIVRIVPIEEWPEAQVDCLAEEGFSASVYSGGAVEYADVPKEQGPALNLAVYVCEAKYPYDVRRNEPLPEKQATAQFEFFK… |
| A0A2H6H6F2 | 115-243 | TYEVTGLIVECVRDQGFAVTLDPDGGIGYASVPPEQNQLADAAYYACKAGLHVPKPEPLTMEQLEKMYAYVVALVGCLESQGYSVAD… |
| A0A7K3WBJ3 | 112-239 | None |
| A0A7D4U8E3 | 2-137 | None |
| A0A7D4UJT6 | 138-281 | None |
| A0A7G5LWR4 | 284-432 | None |
| A0A0Q5WQ96 | 14-189 | None |
| A0A399Y5S4 | 103-287 | None |
| A0A2S5VE60 | 200-369 | None |
| A0A4R8VAS5 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.