DPCstruct | MC5290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 166 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5YL73 | 123-289 | LVRVGREADVDAAHLLLRAHSFWRKRNFKVDLVLLNIGDSGYEGITQDTIRRLLAKHSVEAFVGGRGGIFPLTADSLGPEEVVLLET… |
| A0A810ZKN7 | 1-172 | MILNITHSDSIPLINTLMQAHHYWRLKGLAVDLVILNDGPGGYQQTLHNQIMDLIAAKSAPGMTDKSGGIFLRNGQHLSAEDRTLLL… |
| A0A7G6A4J2 | 1-169 | None |
| A0A1A0DLM6 | 242-388 | None |
| R5Y5J8 | 493-644 | None |
| A0A485D6I4 | 652-818 | None |
| A0A7G5ZJ14 | 1-200 | None |
| A0A1Q8A1K6 | 551-728 | None |
| A0A257MX23 | 167-334 | None |
| G6EK92 | 188-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.