DPCstruct | MC529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 191 ± 30 aa |
| Standard deviation of domain lengths | 29.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A198XW73 | 4-197 | YIVILSIGPVQGMIASARRSRDLWSGSWLLSELAKTCAKFFKDNGATLIFPFIQHDRDLDENSWFSVGNKIQVQLRANDTHALKHII… |
| A0A1H6F8F8 | 2-170 | RYFYFTLGPVQDFVSQARRTRDFWAGSFLLSWLSAVAMQSVKNQCTTAELLPEADTHFLDCLQGRGTGKKPTQGSVPNRFRAAVCGG… |
| A0A1Y1Q181 | 4-213 | None |
| A0A661SGW8 | 4-138 | None |
| A0A6L4ZTU0 | 3-212 | None |
| A0A1V1P7B9 | 2-135 | None |
| A0A538QEB2 | 4-171 | None |
| A0A538PUS2 | 3-209 | None |
| S3IW27 | 1-196 | None |
| A0A7V1SAW1 | 2-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.