DPCstruct | MC52898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3NYA9 | 85-225 | LREQIAALERSGAYPALDRSADIAGPDANGNGVRDDIEAWINSQQLSDAQKKALMQRGRALQKTLLVSLADQAALQVTGEGLMASSK… |
| A0A0G1YR73 | 9-136 | LPPPPDLAQVDATIEGIDANGNGIRDDVEFAIFEKYPNDIKIRAATLQYAKALQQGLTQVTNSGTWIAASQQEERSLRCILENVSQT… |
| A0A1W1UN86 | 18-156 | None |
| A0A7T9C877 | 116-239 | None |
| A0A1F3SVL4 | 431-567 | None |
| A0A2S8RMU5 | 15-148 | None |
| A0A4U1WAN5 | 6-133 | None |
| A0A0S8CU15 | 103-229 | None |
| A0A7W2RMB8 | 103-236 | None |
| A0A0B8P029 | 125-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.