DPCstruct | MC52895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6DFA2 | 369-444 | NQISLSTGWNFVGYNLLEERSVEALFGSIMDDVSSIWSFSEGKWSWYDTSVPLVTLNNLNPGKGYWIKMKKPAVLN |
| A0A7K3YA60 | 137-221 | TVPAAKTLSPGWNAIGYSDLTPSSANETLASVEDGWVYVLGYDAQNQEYQPALINDQIGPRGENQNLFPTEGYWLFMRTDGTLAA |
| A0A5A7RQK4 | 3-111 | None |
| A0A6L7YJ29 | 41-119 | None |
| A0A1V1NTK2 | 1-99 | None |
| A0A1V1NUI9 | 169-246 | None |
| A0A1V1NX06 | 159-236 | None |
| A0A1V4UD37 | 419-498 | None |
| A0A1V1P8N8 | 201-283 | None |
| A0A256WA86 | 155-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.