DPCstruct | MC52893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9GIK6 | 30-146 | SSKRDTTKYIFDGEKHGKGRLALAIVKKYMEENPQTSANELMTVFDKSLQGSYDVIQKIEDAKKNRTDYKKRFFALPNEVIKTSTET… |
| A0A2N6D5U5 | 34-171 | EAKDYQNKIKEQKEERRETRESSRDYTRYTCDNIKGLTKRGLVFVVWTEYLKSNSNITMDKLESAFPKDIRGKLFVTKEHALDQQKR… |
| A0A7X8WBW7 | 15-125 | None |
| A0A2W2AK29 | 73-196 | None |
| R5BP20 | 57-186 | None |
| A0A234QB43 | 2-107 | None |
| E0USQ7 | 2-86 | None |
| A0A1I0M6B3 | 551-684 | None |
| A0A1H7KF43 | 289-427 | None |
| F2NT85 | 141-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.