DPCstruct | MC5289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 339 ± 53 aa |
| Standard deviation of domain lengths | 52.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810ZJ65 | 89-459 | DRMGNTFIDGELVRKYLAEPQDAWKAMLTLNDGGMRRLTEALRRVAHLDFKLKRLHQQLVQCRHETGDQQLGRWYEQGGEDQRAKKQ… |
| A0A381H3Z9 | 2-279 | QRLVEWLSQATSPLQRQARLASLCEQHQQRLHDLLLSHITPKDSGSMATESVIRQLQGQAARHGELLDGLLPPIHHFESLLRIQQPR… |
| A0A0H2YJ06 | 51-431 | None |
| A0A7X3NB15 | 378-727 | None |
| A0A5B0SU37 | 337-707 | None |
| A0A080K8W7 | 13-357 | None |
| A0A4U9HG27 | 127-424 | None |
| A0A847LAR3 | 232-567 | None |
| K8CB69 | 32-301 | None |
| A0A7Y4UPV0 | 544-821 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.