DPCstruct | MC52889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6ATB3 | 12-123 | GFISEDDFYFFKIIHDVKAAVKEITGFYRIYHSARWVGGKLVIRIARALSAASVAELNNKFADVLRRGSIVQSKALPQERNEPEILA… |
| A0A2V6NTN8 | 104-222 | FVRDTLVTQRLIEPTDMALFRVVGSVDEAIAEIMRFYRVFHSARIVGDNIVFRLRRPLSGSALRELQQRFEDILKGPADQTAGPLPQ… |
| A0A3M5DEV8 | 194-314 | None |
| A0A7Y3K5Z8 | 47-196 | None |
| A0A2R7SLG6 | 23-143 | None |
| I4FSF2 | 2-84 | None |
| A0A538JPC9 | 224-344 | None |
| A0A812Q8X1 | 40-181 | None |
| A0A6J6AV52 | 3-95 | None |
| A0A3M5W5B4 | 13-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.