DPCstruct | MC52888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7SG72 | 13-141 | HDLPSSGIGGPRRFEATRWHVVRAAADPASPDAEQALATLFRTYWYPLYAYLRRQGHAREDARDLIQAFFVKLLEEGTIGVADPGRG… |
| A0A2V6AMB5 | 1-128 | MPPALQTTTRESSFASTRWTVVHQAADSQTPSQHALSALSELCQIYWRPVYVFLRRQGIAQHDAQDLTQGFFADLIESRAYARADPT… |
| A0A522S1B8 | 217-347 | None |
| A0A5C6E5M6 | 1-118 | None |
| A0A3E0NNK1 | 193-328 | None |
| A0A7X8UN75 | 1-128 | None |
| A0A2V5LR34 | 13-121 | None |
| A0A838TFY0 | 1-151 | None |
| A0A4Q3AFH8 | 1-157 | None |
| A0A517MIJ5 | 13-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.