DPCstruct | MC52885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315Y4P2 | 52-161 | MTPEDYLMQIKDISLRIKSLEGELHDAEAEEDTEYAEELSARISADIARYKELRLRIRDEIQQIGDNRLSCLLTEYYVRGKTWEMVA… |
| A0A7T8V4J3 | 9-149 | KDESYIDATKRLLKGYRAAKISLSGRKKELENLAEDLVSLPALSCGDKVQTSLSGNPTEDDALELIEKKKEIESGIRRDEILIERVE… |
| W4CH06 | 118-268 | None |
| A0A1Y4HWY5 | 99-251 | None |
| A0A069RGI1 | 14-149 | None |
| A0A7X9GB27 | 2-113 | None |
| A0A4P8K9T1 | 5-143 | None |
| A0A265Q8H1 | 2-114 | None |
| A0A3E2UFA2 | 19-171 | None |
| A0A5Q2RV19 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.