DPCstruct | MC52882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 205 ± 39 aa |
| Standard deviation of domain lengths | 39.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF07195- PF02465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8JXW4 | 383-618 | IESDSNQVEDVIAGLTLDLRAVSDGAVTVNVTRDESGIVESVESFVAAFNDVIDRINTYDTYDSETESRGPLLGDPTVSRVRSELYR… |
| A0A2T0AQP9 | 109-262 | TVSVAAANASYTLNGVPYTSESNTIYLDNRRLTLNLLGPVTGATITVTPDTQAISNAINNFVTAYNNLVTFTAQNSQYISPQLLSIL… |
| A0A839A203 | 43-209 | None |
| A0A1G1CZP5 | 510-738 | None |
| A0A520HZS3 | 4-224 | None |
| A0A7X9HG12 | 289-524 | None |
| A0A1E4LMT5 | 415-653 | None |
| A0A3D0X1L2 | 107-272 | None |
| A0A7Y0WYZ1 | 63-260 | None |
| A0A484Y4Y2 | 3-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.