DPCstruct | MC52873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 211 |
|---|---|
| Mean domain length (aa) | 152 ± 27 aa |
| Standard deviation of domain lengths | 27.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.29 |
| Pfam Score | 91.30 |
| Assigned Pfam label(s) | PF14104- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8CYC4 | 30-194 | TKPGRDCRLATHRLVWRFDAAAQEEDEQYDGYSALVTTVPRTSVDALFTKLKEQNQVEHVNSRFKGPLAVRPVYLHSPRRVESLTFV… |
| A0A355M4Q8 | 210-382 | SQAKLRYANTRKPCTVFASATYQASTWSKPRRIICSVIVNKLGVEDVRYIVTSFENAGAKYLYETVYCGRGNAERYIKDQKTGLNSD… |
| A0A395WA71 | 19-169 | None |
| A0A538Q0F3 | 538-751 | None |
| A0A5F0B8V7 | 1-139 | None |
| A0A7V3AEA4 | 1-123 | None |
| A0A7C5YWI7 | 199-389 | None |
| A0A7C5YXZ3 | 1-118 | None |
| A0A5J4KTQ4 | 228-391 | None |
| A0A0D0SJ65 | 97-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.