DPCstruct | MC52870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 671 ± 71 aa |
| Standard deviation of domain lengths | 71.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6F9B8 | 1-669 | MLILWGYEGPPTLQDCKDKLSIDKKLVEDFTEILNKIEKRDIYDLNHTPEHLKNDISRVAKQMICNLSQRLRKLRTVKQSKKTVKVT… |
| A0A8B6GX70 | 302-834 | VKVVSVRIKDLRMLFLKQQMALNKFMKEGGKDWKKSKYVYAISSVQAQMFLIRNVVKKLLDSNSSLLLLGSLINGTSQLFSENQSID… |
| A0A8B6F3A4 | 217-977 | None |
| A0A8B6C6E2 | 4-573 | None |
| A0A8B6DAD6 | 237-922 | None |
| A0A6J8CVK3 | 3-691 | None |
| A0A8B6EGR7 | 1-686 | None |
| A0A6J8CW16 | 216-908 | None |
| A0A6J8B8L1 | 1-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.