DPCstruct | MC52867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 309 ± 76 aa |
| Standard deviation of domain lengths | 76.23 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6F403 | 2-292 | NNDNIFKVLKKIGTTVSRETCTNLSPDEELDIAVDFSKWEEYADLAIYNSNYLSAQIQKYGGSLEAFHESLCHDLVTNVVVTAKPEI… |
| J9M5R2 | 2-174 | RFKVMANVAVNRANMLTRIWKYGDPEVTASEYLLHAGVISMVEFDNDIFAAGNCYDQHQYKKYWLFCPYAYRLPDGDGILAKDLAVE… |
| B7QAZ6 | 39-294 | None |
| A0A1I8IUR5 | 295-653 | None |
| A0A1I8I2D2 | 191-527 | None |
| A0A482WKP8 | 3-195 | None |
| A0A267FTW9 | 361-892 | None |
| A0A4C1TK57 | 357-616 | None |
| A0A665UK51 | 52-365 | None |
| A0A0J7K9J5 | 4-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.