DPCstruct | MC5286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15532 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7GTX9 | 1-73 | MVRIHDIDASAPVGANASQGWVVRIFDGKRSMDINGIYHPPGIFNPGSPNYSPSIINDVHIPINKPISFPGVP |
| A0A1E5KX71 | 25-105 | EYTWKTSEGAKMTVRVHGPDASAPAGSNAANDWVVRVQQGKKYLDPISGEFQPPGISRPNSEFYNEELINNTNIPIQAPKK |
| A0A0K9MJI5 | 133-214 | None |
| D9VS65 | 1-85 | None |
| A0A849C9C3 | 298-380 | None |
| A0A4U7KDK0 | 50-131 | None |
| A0A6P1AAW9 | 65-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.