DPCstruct | MC52859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 548 ± 55 aa |
| Standard deviation of domain lengths | 54.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9RM86 | 2-515 | EAKELQANFVHLSLLSKYYKRAYQEFFKSSEADKDLVDASSSSSSSSGTISDYYKFGWLLFLALRVHAFSRFKDLVTCTNGLVSVLA… |
| A0A671W0E9 | 8-468 | QKRLWGACLFVSATDMDVSCFTFTQVLKAVSLNVKQFFTLVRKLDVNLDTISTKVNSALTRLEKKYDVTLALYQRFEKETIRSCWTM… |
| A0A6A4WHR6 | 2-554 | None |
| A0A397CER1 | 1-596 | None |
| A0A2U1MJ93 | 2-452 | None |
| A0A183F485 | 88-587 | None |
| A0A0C2JEK9 | 12-583 | None |
| B4DT45 | 4-548 | None |
| A0A4Z2DE71 | 1-635 | None |
| A0A4W3JFV8 | 8-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.