DPCstruct | MC52854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C2Z4N2 | 1-123 | MDTWKKGFGENLEEVDNALIKVYQNMRDVPHEELQGASENVLTLAKLYDVDLNEATRGAGQVMSQFNLSTQETFDLLAAGAQAGLNY… |
| A0A6H5REI9 | 163-312 | KFYATTNLSGQALENLKAVAQDVFKTGVTDSIDEATDATSLMKQAFKDLNDTDLAKLTSQVMLLSDRTGTDVAENVTGTTQLMKAFG… |
| A0A2B3QD49 | 302-452 | None |
| J8AVZ9 | 3-102 | None |
| A0A412XZJ6 | 205-345 | None |
| A0A6H0UJ97 | 44-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.