DPCstruct | MC52852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.15 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF06150- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2G1J6 | 119-252 | MPKTKRSGAAKQDEIPATLQRSDAKAQRTFAHAYDAAIEQYDGDEDAAHRVAFAALKHTHEKVGDSWRPKDEPGPSDRRAEEGYGST… |
| A0A3E0H793 | 4-130 | AKELPSTLKRSSQKAQRTWIKAHDSAVDEYGEGRRSHQTAFAALKHGFEKVGDHWEAKRNKGPSDRQAAQSNRAKPRKTAGGVDANA… |
| A0A7T4T5A7 | 183-315 | None |
| A0A379JL61 | 1-141 | None |
| A0A5S4GPN4 | 1-126 | None |
| A0A522C244 | 1-133 | None |
| F8B2S5 | 10-157 | None |
| A0A2P9IBD5 | 5-127 | None |
| A0A248YLK1 | 1-132 | None |
| A0A251XKA4 | 50-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.