DPCstruct | MC52850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 180 ± 20 aa |
| Standard deviation of domain lengths | 20.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A552FZ29 | 1-183 | MSKFHEEHPYQLDGMIKIVWHPEIKANPDVQPFPIEMKYEPAETKTPVHTGNSNWRGPVWFPMNFLIIESLKKFYEYFNVCLKEEDF… |
| A0A1V5DY36 | 91-267 | ERLRRILAKMLDENEFMGPCGIRSLSKFHQRNPFVFHVNGRQYRVDYLPAESNTGMFGGNSNWRGPVWMPVNALIIRALLNFYLYYG… |
| A0A0G4NBE7 | 229-399 | None |
| A0A651FPA9 | 183-363 | None |
| A0A7D8Z176 | 459-686 | None |
| A0A812TW33 | 40-193 | None |
| A0A1X7M832 | 71-230 | None |
| A0A2Z6UWR0 | 208-411 | None |
| A0A167F813 | 643-863 | None |
| A0A534WKT9 | 25-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.